- PDCD10 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-86574
- Unconjugated
- Rabbit
- Immunohistochemistry, Immunohistochemistry-Paraffin
- 0.1 ml (also 25ul)
- CCM3, TFAR15
- Human
- This antibody was developed against Recombinant Protein corresponding to amino acids: MRMTMEEMKN EAETTSMVSM PLYAVMYPVF NELERVNLSA AQTLRAAFIK AEKENPGLTQ DIIMK
- PBS (pH 7.2) and 40% Glycerol
- PDCD10
- programmed cell death 10
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Angiogenesis, Apoptosis, Cardiovascular Biology, Cell Biology, Neuroscience, Signal Transduction
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMK
Specifications/Features
Available conjugates: Unconjugated